General Information

  • ID:  hor002417
  • Uniprot ID:  P91691(83-92)
  • Protein name:  Leucomyosuppressin
  • Gene name:  NA
  • Organism:  Diploptera punctata (Pacific beetle cockroach)
  • Family:  Myosuppressin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Diploptera (genus), Diplopterinae (subfamily), Blaberidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  QDVDHVFLRF
  • Length:  10(83-92)
  • Propeptide:  MKHLCIVLIGVLTVLLACAPRRAAAVPPPQCSSNMLEDISPRFRKICAALSSIYDLSSAMEAYLEDKVVRENTPLMDNGVKRQDVDHVFLRFGRRR
  • Signal peptide:  MKHLCIVLIGVLTVLLACAPRRAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  an inhibitor of spontaneous hindgut contraction
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P91691-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002417_AF2.pdbhor002417_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 143615 Formula: C59H86N16O16
Absent amino acids: ACEGIKMNPSTWY Common amino acids: DFV
pI: 5.41 Basic residues: 2
Polar residues: 0 Hydrophobic residues: 5
Hydrophobicity: -4 Boman Index: -2360
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 97
Instability Index: 3249 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9114465
  • Title:  Molecular Characterization of the Inhibitory Myotropic Peptide Leucomyosuppressin